| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIKFyve/PIP5K3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIKFyve/PIP5K3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIKFyve/PIP5K3. This antibody reacts with human. The PIKFyve/PIP5K3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PIKFyve/PIP5K3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQA |
|---|
| Other Names | 1-phosphatidylinositol-3-phosphate 5-kinase, EC 2.7.1.150, FLJ37746, FYVE finger-containing phosphoinositide kinase, KIAA0981CFD, MGC40423, p235, Phosphatidylinositol-3-phosphate 5-kinase, Phosphatidylinositol-3-phosphate 5-kinase type III, phosphoinositide kinase, FYVE finger containing, PIKfyve, PIP5K, PIP5K3FAB1, PIPkin-III, type III, Type III PIP kinase |
|---|
| Gene, Accession # | PIKFYVE, Gene ID: 200576 |
|---|
| Catalog # | NBP1-89613 |
|---|
| Price | |
|---|
| Order / More Info | PIKFyve/PIP5K3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|