| Edit |   |
| Antigenic Specificity | SPATA24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPATA24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA24. This antibody reacts with human. The SPATA24 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SPATA24 (spermatogenesis associated 24) The peptide sequence was selected from the c terminal of SPATA24 )(50ug). Peptide sequence LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ. |
| Other Names | spermatogenesis associated 24, spermatogenesis-associated protein 24 |
| Gene, Accession # | SPATA24, Gene ID: 202051 |
| Catalog # | NBP1-70709 |
| Price | |
| Order / More Info | SPATA24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |