| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPATA20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPATA20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA20. This antibody reacts with human. The SPATA20 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKV |
|---|
| Other Names | DKFZp686H1839, FLJ21347, FLJ21969, MGC111032, sperm protein SSP411, spermatogenesis associated 20, spermatogenesis-associated protein 20, Sperm-specific protein 411, Ssp411, Tisp78, transcript increased in spermiogenesis 78 |
|---|
| Gene, Accession # | SPATA20, Gene ID: 64847 |
|---|
| Catalog # | NBP1-82147 |
|---|
| Price | |
|---|
| Order / More Info | SPATA20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|