| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIGN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIGN Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIGN. This antibody reacts with human. The PIGN Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PIGN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGIKYPQRVSAQQFDDAFLKEWRLENWK |
|---|
| Other Names | EC 2.-, GPI ethanolamine phosphate transferase 1, MCD4, MCD4 homolog, MDC4, MGC26427, phosphatidylinositol glycan anchor biosynthesis, class N, Phosphatidylinositol-glycan biosynthesis class N protein, PIG-Nphosphatidylinositol glycan, class N |
|---|
| Gene, Accession # | PIGN, Gene ID: 23556 |
|---|
| Catalog # | NBP1-81248 |
|---|
| Price | |
|---|
| Order / More Info | PIGN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|