| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIGM |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIGM Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIGM. This antibody reacts with human. The PIGM Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PIGM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT |
|---|
| Other Names | EC 2.4.1, EC 2.4.1.-, GPI mannosyltransferase 1, GPI mannosyltransferase I, GPI-MT-IPIG-M mannosyltransferase, MGC29896, phosphatidylinositol glycan anchor biosynthesis, class M, phosphatidylinositol glycan, class M, Phosphatidylinositol-glycan biosynthesis class M protein, PIG-M |
|---|
| Gene, Accession # | PIGM, Gene ID: 93183 |
|---|
| Catalog # | NBP2-13761 |
|---|
| Price | |
|---|
| Order / More Info | PIGM Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|