| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HNF-3 alpha/FoxA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HNF-3 alpha/FoxA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HNF-3 alpha/FoxA1. This antibody reacts with human. The HNF-3 alpha/FoxA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HNF-3 alpha/FoxA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP |
|---|
| Other Names | forkhead box A1, Forkhead box protein A1, hepatocyte nuclear factor 3, alpha, hepatocyte nuclear factor 3-alpha, HNF-3A, HNF-3-alpha, HNF3ATCF-3A, MGC33105, TCF3A, Transcription factor 3A |
|---|
| Gene, Accession # | FOXA1, Gene ID: 3169, Accession: P55317, SwissProt: P55317 |
|---|
| Catalog # | NBP2-38628 |
|---|
| Price | |
|---|
| Order / More Info | HNF-3 alpha/FoxA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|