| Edit |   |
|---|
| Antigenic Specificity | C11orf74 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C11orf74 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C11orf74. This antibody reacts with human. The C11orf74 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C11ORF74 The peptide sequence was selected from the middle region of C11ORF74. Peptide sequence VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD. |
|---|
| Other Names | chromosome 11 open reading frame 74, FLJ38678, HEPIS, hypothetical protein LOC119710, Protein HEPIS |
|---|
| Gene, Accession # | C11ORF74, Gene ID: 119710, Accession: Q86VG3, SwissProt: Q86VG3 |
|---|
| Catalog # | NBP1-56712 |
|---|
| Price | |
|---|
| Order / More Info | C11orf74 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|