| Edit |   |
| Antigenic Specificity | C11orf65 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C11orf65 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C11orf65. This antibody reacts with human. The C11orf65 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human C11orf65. Peptide sequence MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI. |
| Other Names | chromosome 11 open reading frame 65 |
| Gene, Accession # | C11ORF65, Gene ID: 160140, Accession: NP_689800, SwissProt: NP_689800 |
| Catalog # | NBP1-91439-20ul |
| Price | |
| Order / More Info | C11orf65 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |