| Edit |   |
| Antigenic Specificity | C11orf53 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C11orf53 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C11orf53. This antibody reacts with human. The C11orf53 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C11ORF53 The peptide sequence was selected from the middle region of C11ORF53. Peptide sequence SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN. |
| Other Names | chromosome 11 open reading frame 53, hypothetical protein LOC341032, MGC50104 |
| Gene, Accession # | C11ORF53, Gene ID: 341032, Accession: Q8IXP5, SwissProt: Q8IXP5 |
| Catalog # | NBP1-57594-20ul |
| Price | |
| Order / More Info | C11orf53 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |