| Edit |   |
| Antigenic Specificity | C11orf53 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C11orf53 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C11orf53. This antibody reacts with human. The C11orf53 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C11orf53 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: STSCLSQLESGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKV |
| Other Names | chromosome 11 open reading frame 53, hypothetical protein LOC341032, MGC50104 |
| Gene, Accession # | C11ORF53, Gene ID: 341032, Accession: Q8IXP5, SwissProt: Q8IXP5 |
| Catalog # | NBP2-37953 |
| Price | |
| Order / More Info | C11orf53 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |