| Edit |   |
| Antigenic Specificity | C11orf16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C11orf16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C11orf16. This antibody reacts with human. The C11orf16 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human C11orf16. Peptide sequence EPCLGKPGTRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTP. |
| Other Names | chromosome 11 open reading frame 16, hypothetical protein LOC56673 |
| Gene, Accession # | C11ORF16, Gene ID: 56673, Accession: NP_065694, SwissProt: NP_065694 |
| Catalog # | NBP1-91488-20ul |
| Price | |
| Order / More Info | C11orf16 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |