| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Connexin 36/GJD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. This Connexin 36/GJA9 antibody is useful for Western blot and Immunohistochemistry-Frozen applications. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25197082). Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 30412665). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Connexin 36/GJD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Connexin 36/GJD2. This antibody reacts with human, mouse. The Connexin 36/GJD2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. |
|---|
| Immunogen | Synthetic peptides corresponding to GJD2(gap junction protein, delta 2, 36kDa) The peptide sequence was selected from the middle region of GJD2. Peptide sequence ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY. |
|---|
| Other Names | Connexin-36, Cx36, CX36connexin 36, Gap junction alpha-9 protein, gap junction delta-2 protein, gap junction protein, alpha 9, 36kDa, gap junction protein, delta 2, 36kDa, GJA9connexin-36, MGC138315, MGC138319 |
|---|
| Gene, Accession # | GJD2, Gene ID: 57369, Accession: Q9UKL4, SwissProt: Q9UKL4 |
|---|
| Catalog # | NBP1-59254 |
|---|
| Price | |
|---|
| Order / More Info | Connexin 36/GJD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25197082, 30412665 |
|---|
| 产品资料 |
|
|