| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Connexin 32/GJB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Connexin 32/GJB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Connexin 32/GJB1. This antibody reacts with human. The Connexin 32/GJB1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to GJB1 (gap junction protein, beta 1, 32kDa) The peptide sequence was selected from the C terminal of GJB1. Peptide sequence GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC. |
|---|
| Other Names | CMTX, Connexin-32, Cx32, CX32beta 1, 32kD (connexin 32, Charcot-Marie-Toothneuropathy, X-linked), gap junction beta-1 protein, gap junction protein, beta 1, 32kDa, gap junction protein, beta 1, 32kDa (connexin 32), gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Toothneuropathy, X-linked) |
|---|
| Gene, Accession # | GJB1, Gene ID: 2705, Accession: P08034, SwissProt: P08034 |
|---|
| Catalog # | NBP1-59139 |
|---|
| Price | |
|---|
| Order / More Info | Connexin 32/GJB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|