| Edit |   |
|---|
| Antigenic Specificity | Carboxypeptidase A2/CPA2 |
|---|
| Clone | 2E11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carboxypeptidase A2/CPA2 Antibody (2E11) from Novus Biologicals is a mouse monoclonal antibody to Carboxypeptidase A2/CPA2. This antibody reacts with human. The Carboxypeptidase A2/CPA2 Antibody (2E11) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation. |
|---|
| Immunogen | CPA2 (NP_001860 117 a.a. - 206 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT* |
|---|
| Other Names | carboxypeptidase A2, carboxypeptidase A2 (pancreatic), EC 3.4.17, EC 3.4.17.15 |
|---|
| Gene, Accession # | CPA2, Gene ID: 1358, Accession: NP_001860, SwissProt: NP_001860 |
|---|
| Catalog # | H00001358-M02 |
|---|
| Price | |
|---|
| Order / More Info | Carboxypeptidase A2/CPA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|