| Edit |   |
|---|
| Antigenic Specificity | Carboxypeptidase A2/CPA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carboxypeptidase A2/CPA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carboxypeptidase A2/CPA2. This antibody reacts with human. The Carboxypeptidase A2/CPA2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Carboxypeptidase A2/CPA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNV |
|---|
| Other Names | carboxypeptidase A2, carboxypeptidase A2 (pancreatic), EC 3.4.17, EC 3.4.17.15 |
|---|
| Gene, Accession # | CPA2, Gene ID: 1358 |
|---|
| Catalog # | NBP1-86028 |
|---|
| Price | |
|---|
| Order / More Info | Carboxypeptidase A2/CPA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|