| Edit |   |
|---|
| Antigenic Specificity | LIMD1 |
|---|
| Clone | 2G5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LIMD1 Antibody (2G5) from Novus Biologicals is a mouse monoclonal antibody to LIMD1. This antibody reacts with human. The LIMD1 Antibody (2G5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | LIMD1 (NP_055055.1 577 a.a. - 674 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKRPSSTALHQH |
|---|
| Other Names | LIM domain-containing protein 1, LIM domains containing 1 |
|---|
| Gene, Accession # | LIMD1, Gene ID: 8994, Accession: NP_055055, SwissProt: NP_055055 |
|---|
| Catalog # | H00008994-M01 |
|---|
| Price | |
|---|
| Order / More Info | LIMD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|