| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase XII/CA12 |
|---|
| Clone | 1D4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for RNAi Validation. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase XII/CA12 Antibody (1D4) from Novus Biologicals is a mouse monoclonal antibody to Carbonic Anhydrase XII/CA12. This antibody reacts with human. The Carbonic Anhydrase XII/CA12 Antibody (1D4) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | CA12 (NP_996808, 25 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN |
|---|
| Other Names | Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3 |
|---|
| Gene, Accession # | CA12, Gene ID: 771, Accession: NP_996808, SwissProt: NP_996808 |
|---|
| Catalog # | H00000771-M01 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase XII/CA12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|