| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase VII/CA7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase VII/CA7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbonic Anhydrase VII/CA7. This antibody reacts with human. The Carbonic Anhydrase VII/CA7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. |
|---|
| Other Names | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
|---|
| Gene, Accession # | CA7, Gene ID: 766, Accession: Q86YU0, SwissProt: Q86YU0 |
|---|
| Catalog # | NBP1-68888 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase VII/CA7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|