| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase VII/CA7 |
|---|
| Clone | 3B7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase VII/CA7 Antibody (3B7) from Novus Biologicals is a mouse monoclonal antibody to Carbonic Anhydrase VII/CA7. This antibody reacts with human. The Carbonic Anhydrase VII/CA7 Antibody (3B7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CA7 (NP_005173, 34 a.a. - 125 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVH* |
|---|
| Other Names | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
|---|
| Gene, Accession # | CA7, Gene ID: 766, Accession: NP_005173, SwissProt: NP_005173 |
|---|
| Catalog # | H00000766-M06 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase VII/CA7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|