| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase VII/CA7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase VII/CA7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbonic Anhydrase VII/CA7. This antibody reacts with human. The Carbonic Anhydrase VII/CA7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Carbonic Anhydrase VII/CA7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVV |
|---|
| Other Names | Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 |
|---|
| Gene, Accession # | CA7, Gene ID: 766, Accession: P43166, SwissProt: P43166 |
|---|
| Catalog # | NBP2-30702 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase VII/CA7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|