| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase VI |
|---|
| Clone | 1G12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase VI Antibody (1G12) from Novus Biologicals is a mouse monoclonal antibody to Carbonic Anhydrase VI. This antibody reacts with human. The Carbonic Anhydrase VI Antibody (1G12) has been validated for the following applications: ELISA. |
|---|
| Immunogen | CA6 (NP_001206.2 209 a.a. - 308 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |
|---|
| Other Names | Carbonate dehydratase VI, carbonic anhydrase 6, carbonic anhydrase VIGUSTIN, CA-VI, EC 4.2.1.1, MGC21256, Salivary carbonic anhydrase, Secreted carbonic anhydrase |
|---|
| Gene, Accession # | CA6, Gene ID: 765, Accession: NP_001206, SwissProt: NP_001206 |
|---|
| Catalog # | H00000765-M07 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase VI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|