| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ASCL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ASCL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASCL3. This antibody reacts with human. The ASCL3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ASCL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGP |
|---|
| Other Names | achaete-scute complex homolog 3 (Drosophila), ASH-3, bHLH transcription factor Sgn-1 (Salivary Glands 1), bHLH transcriptional regulator Sgn-1, BHLHA42, bHLHa42achaete-scute homolog 3, Class A basic helix-loop-helix protein 42, hASH3, HASH3achaete-scute complex (Drosophila) homolog-like 3, SGN1 |
|---|
| Gene, Accession # | ASCL3, Gene ID: 56676 |
|---|
| Catalog # | NBP1-88635 |
|---|
| Price | |
|---|
| Order / More Info | ASCL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|