| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ASCIZ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ASCIZ Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASCIZ. This antibody reacts with human. The ASCIZ Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ASCIZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQDGIVNPTIRKDLKTGPKFYCCPIEGCPRGPERPFSQFSLVKQHFMKMHAEKKHKC |
|---|
| Other Names | ASCIZ, ATM INteracting protein, ATM interactor, ATM/ATR-substrate CHK2-interacting zinc finger protein, ATM/ATR-Substrate Chk2-Interacting Zn++-finger protein, DKFZp779K1455, FLJ50270, FLJ61620, FLJ76795, KIAA0431, zinc finger protein 822, ZNF822 |
|---|
| Gene, Accession # | ATMIN, Gene ID: 23300 |
|---|
| Catalog # | NBP2-58746 |
|---|
| Price | |
|---|
| Order / More Info | ASCIZ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|