| Edit |   |
| Antigenic Specificity | ZNF418 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF418 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF418. This antibody reacts with human. The ZNF418 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF418The immunogen for this antibody is ZNF418. Peptide sequence HRCEAWGNKLYDSSNRPHQNQYLGEKPYRSSVEEALFVKRCKFHVSEESS. |
| Other Names | FLJ31551, KIAA1956, MGC138449, zinc finger protein 418 |
| Gene, Accession # | ZNF418, Gene ID: 147686, Accession: NP_597717, SwissProt: NP_597717 |
| Catalog # | NBP1-79412 |
| Price | |
| Order / More Info | ZNF418 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |