| Edit |   |
|---|
| Antigenic Specificity | ZNF417 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF417 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF417. This antibody reacts with human. The ZNF417 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF417. Peptide Sequence: HQETHHKQKLNRSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVK |
|---|
| Other Names | MGC34079, zinc finger protein 417 |
|---|
| Gene, Accession # | ZNF417, Gene ID: 147687, Accession: NP_689688, SwissProt: NP_689688 |
|---|
| Catalog # | NBP1-80159 |
|---|
| Price | |
|---|
| Order / More Info | ZNF417 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|