| Edit |   |
|---|
| Antigenic Specificity | ZNF41 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF41 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF41. This antibody reacts with human. The ZNF41 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human ZNF41The immunogen for this antibody is ZNF41. Peptide sequence LRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKT. |
|---|
| Other Names | zinc finger protein 296, Zinc finger protein 342ZFP296ZNF342 |
|---|
| Gene, Accession # | ZNF41, Gene ID: 7592, Accession: NP_700359, SwissProt: NP_700359 |
|---|
| Catalog # | NBP1-79272-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZNF41 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|