| Edit |   |
| Antigenic Specificity | ZNF41 |
| Clone | 4E9 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF41 Antibody (4E9) from Novus Biologicals is a mouse monoclonal antibody to ZNF41. This antibody reacts with human. The ZNF41 Antibody (4E9) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | ZNF41 (NP_009061, 221 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSV* |
| Other Names | zinc finger protein 296, Zinc finger protein 342ZFP296ZNF342 |
| Gene, Accession # | ZNF41, Gene ID: 7592, Accession: NP_009061, SwissProt: NP_009061 |
| Catalog # | H00007592-M01 |
| Price | |
| Order / More Info | ZNF41 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |