| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | V-type proton ATPase subunit F |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The V-type proton ATPase subunit F Antibody from Novus Biologicals is a rabbit polyclonal antibody to V-type proton ATPase subunit F. This antibody reacts with human. The V-type proton ATPase subunit F Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human V-type proton ATPase subunit F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL |
|---|
| Other Names | ATP6S14adenosinetriphosphatase 14k chain, ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F, H(+)-transporting two-sector ATPase, 14kD subunit, MGC117321, MGC126037, MGC126038, vacuolar ATP synthase subunit F, vacuolar proton pump F subunit, Vacuolar proton pump subunit F, VATFATPase, vacuolar, 14 kD, V-ATPase 14 kDa subunit, V-ATPase F subunit, V-ATPase subunit F, Vma7, V-type proton ATPase subunit F |
|---|
| Gene, Accession # | ATP6V1F, Gene ID: 9296, Accession: Q16864, SwissProt: Q16864 |
|---|
| Catalog # | NBP2-38942 |
|---|
| Price | |
|---|
| Order / More Info | V-type proton ATPase subunit F Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|