| Edit |   |
| Antigenic Specificity | VTI1A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VTI1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to VTI1A. This antibody reacts with human. The VTI1A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human VTI1A. Peptide sequence SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL. |
| Other Names | MVti1, vesicle transport through interaction with t-SNAREs homolog 1A, vesicle transport through interaction with t-SNAREs homolog 1A (yeast) |
| Gene, Accession # | VTI1A, Gene ID: 143187, Accession: NP_660207, SwissProt: NP_660207 |
| Catalog # | NBP1-91431 |
| Price | |
| Order / More Info | VTI1A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |