| Edit |   |
|---|
| Antigenic Specificity | Flavin containing monooxygenase 4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Flavin containing monooxygenase 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Flavin containing monooxygenase 4. This antibody reacts with rat. The Flavin containing monooxygenase 4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Fmo4 (flavin containing monooxygenase 4) The peptide sequence was selected from the middle region of Fmo4. Peptide sequence PGIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDVAVELSGIAAQV. |
|---|
| Other Names | dimethylaniline monooxygenase [N-oxide-forming] 4, Dimethylaniline oxidase 4, EC 1.14.13.8, flavin containing monooxygenase 4, FMO 4, FMO2, Hepatic flavin-containing monooxygenase 4 |
|---|
| Gene, Accession # | FMO4, Gene ID: 2329, Accession: Q8K4B7 |
|---|
| Catalog # | NBP1-69026-20ul |
|---|
| Price | |
|---|
| Order / More Info | Flavin containing monooxygenase 4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|