| Edit |   |
|---|
| Antigenic Specificity | PM20D2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PM20D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PM20D2. This antibody reacts with human. The PM20D2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PM20D2(peptidase M20 domain containing 2) The peptide sequence was selected from the middle region of PM20D2. Peptide sequence HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS. |
|---|
| Other Names | aminoacylase-1-like protein 2, bA63L7.3, peptidase M20 domain containing 2, peptidase M20 domain-containing protein 2 |
|---|
| Gene, Accession # | PM20D2, Gene ID: 135293 |
|---|
| Catalog # | NBP1-70678 |
|---|
| Price | |
|---|
| Order / More Info | PM20D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|