| Edit |   |
| Antigenic Specificity | PMCH |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PMCH Antibody from Novus Biologicals is a rabbit polyclonal antibody to PMCH. This antibody reacts with human. The PMCH Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human PMCHThe immunogen for this antibody is PMCH. Peptide sequence RLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHNFL. |
| Other Names | MCHpro-MCH, pro-melanin-concentrating hormone |
| Gene, Accession # | PMCH, Gene ID: 5367, Accession: NP_002665, SwissProt: NP_002665 |
| Catalog # | NBP1-79956 |
| Price | |
| Order / More Info | PMCH Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |