| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PMCA4 |
|---|
| Clone | 2G8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PMCA4 Antibody (2G8) from Novus Biologicals is a mouse monoclonal antibody to PMCA4. This antibody reacts with human. The PMCA4 Antibody (2G8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ATP2B4 (NP_001675, 1 a.a. - 92 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT |
|---|
| Other Names | ATP2B2plasma membrane calcium ATPase, ATPase, Ca++ transporting, plasma membrane 4, DKFZp686G08106, DKFZp686M088, EC 3.6.3, EC 3.6.3.8, Matrix-remodeling-associated protein 1, matrix-remodelling associated 1, MXRA1, Plasma membrane calcium ATPase isoform 4, plasma membrane calcium pump, Plasma membrane calcium pump isoform 4, plasma membrane calcium-transporting ATPase 4, PMCA4b, PMCA4PMCA4x, sarcolemmal calcium pump |
|---|
| Gene, Accession # | ATP2B4, Gene ID: 493, Accession: NP_001675, SwissProt: NP_001675 |
|---|
| Catalog # | H00000493-M07 |
|---|
| Price | |
|---|
| Order / More Info | PMCA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25906147 |
|---|
| 产品资料 |
|
|