| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PMCA4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PMCA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PMCA4. This antibody reacts with human. The PMCA4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ATP2B4(ATPase, Ca++ transporting, plasma membrane 4) The peptide sequence was selected from the middle region of ATP2B4. Peptide sequence FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK. |
|---|
| Other Names | ATP2B2plasma membrane calcium ATPase, ATPase, Ca++ transporting, plasma membrane 4, DKFZp686G08106, DKFZp686M088, EC 3.6.3, EC 3.6.3.8, Matrix-remodeling-associated protein 1, matrix-remodelling associated 1, MXRA1, Plasma membrane calcium ATPase isoform 4, plasma membrane calcium pump, Plasma membrane calcium pump isoform 4, plasma membrane calcium-transporting ATPase 4, PMCA4b, PMCA4PMCA4x, sarcolemmal calcium pump |
|---|
| Gene, Accession # | ATP2B4, Gene ID: 493, Accession: B1APW5, SwissProt: B1APW5 |
|---|
| Catalog # | NBP1-59481 |
|---|
| Price | |
|---|
| Order / More Info | PMCA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|