| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IBRDC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IBRDC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IBRDC2. This antibody reacts with human. The IBRDC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IBRDC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIF |
|---|
| Other Names | bA528A10.3, E3 ubiquitin-protein ligase RNF144B, EC 6.3.2, EC 6.3.2.-, IBR domain containing 2, IBR domain-containing protein 2, IBRDC2, KIAA0161, p53-inducible RING finger protein, P53RFP, PIR2, ring finger protein 144BMGC71786 |
|---|
| Gene, Accession # | RNF144B, Gene ID: 255488, Accession: Q7Z419, SwissProt: Q7Z419 |
|---|
| Catalog # | NBP2-37941 |
|---|
| Price | |
|---|
| Order / More Info | IBRDC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|