| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | iASPP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The iASPP Antibody from Novus Biologicals is a rabbit polyclonal antibody to iASPP. This antibody reacts with human. The iASPP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human iASPP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL |
|---|
| Other Names | IASPPinhibitor of apoptosis stimulating protein of p53, Inhibitor of ASPP protein, NFkB-interacting protein 1, NKIP1, PPP1R13BL, PPP1R13B-like protein, Protein iASPP, protein phosphatase 1, regulatory (inhibitor) subunit 13 like, protein phosphatase 1, regulatory subunit 13 like, RAINFkB interacting protein 1, relA-associated inhibitor |
|---|
| Gene, Accession # | PPP1R13L, Gene ID: 10848, Accession: Q8WUF5, SwissProt: Q8WUF5 |
|---|
| Catalog # | NBP2-38879 |
|---|
| Price | |
|---|
| Order / More Info | iASPP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|