| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IARS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IARS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IARS2. This antibody reacts with human. The IARS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAARDDISKLRNTLRFLLGNVADFNPETDSIPVNDMYV |
|---|
| Other Names | EC 6.1.1, EC 6.1.1.5, FLJ10326, ILERS, isoleucine tRNA ligase 2, mitochondrial, Isoleucine--tRNA ligase, isoleucine-tRNA synthetase 2, mitochondrial, isoleucyl-tRNA synthetase 2, mitochondrial, isoleucyl-tRNA synthetase, mitochondrial, mitochondrial isoleucine tRNA synthetase |
|---|
| Gene, Accession # | IARS2, Gene ID: 55699 |
|---|
| Catalog # | NBP1-84639 |
|---|
| Price | |
|---|
| Order / More Info | IARS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21945886 |
|---|
| 产品资料 |
|
|