| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IA-2/PTPRN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IA-2/PTPRN Antibody from Novus Biologicals is a rabbit polyclonal antibody to IA-2/PTPRN. This antibody reacts with human. The IA-2/PTPRN Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human IA-2/PTPRN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA |
|---|
| Other Names | CA 512, EC 3.1.3.48, FLJ16131, IA2, IA-2, IA-2/PTP, ICA 512, ICA3, ICA512, islet cell antigen 2, Islet cell antigen 512, Islet cell autoantigen 3, protein tyrosine phosphatase, receptor type, N, protein tyrosine phosphatase-like N, PTP IA-2, receptor-type tyrosine-protein phosphatase-like N, R-PTP-N |
|---|
| Gene, Accession # | PTPRN, Gene ID: 5798 |
|---|
| Catalog # | NBP2-58897 |
|---|
| Price | |
|---|
| Order / More Info | IA-2/PTPRN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|