| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBL7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBL7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBL7. This antibody reacts with human. The UBL7 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human UBL7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELS |
|---|
| Other Names | BMSCUBP, BMSC-UbPTCBA1, Bone marrow stromal cell ubiquitin-like protein, MGC14421, ubiquitin-like 7 (bone marrow stromal cell-derived), ubiquitin-like protein 7, Ubiquitin-like protein SB132 |
|---|
| Gene, Accession # | UBL7, Gene ID: 84993 |
|---|
| Catalog # | NBP2-58983 |
|---|
| Price | |
|---|
| Order / More Info | UBL7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|