| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMARCD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMARCD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMARCD3. This antibody reacts with human. The SMARCD3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SMARCD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPA |
|---|
| Other Names | 60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010, Rsc6p, subfamily d, member 3, SWI/SNF complex 60 kDa subunit C, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3, Swp73-like protein |
|---|
| Gene, Accession # | SMARCD3, Gene ID: 6604, Accession: Q6STE5, SwissProt: Q6STE5 |
|---|
| Catalog # | NBP2-39013 |
|---|
| Price | |
|---|
| Order / More Info | SMARCD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|