| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMARCD2 |
|---|
| Clone | 2C2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMARCD2 Antibody (2C2) from Novus Biologicals is a mouse monoclonal antibody to SMARCD2. This antibody reacts with human, mouse, rat. The SMARCD2 Antibody (2C2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SMARCD2 (NP_003068 398 a.a. - 474 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL |
|---|
| Other Names | 60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein |
|---|
| Gene, Accession # | SMARCD2, Gene ID: 6603 |
|---|
| Catalog # | H00006603-M03 |
|---|
| Price | |
|---|
| Order / More Info | SMARCD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|