| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMARCD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMARCD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMARCD2. This antibody reacts with human. The SMARCD2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SMARCD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR |
|---|
| Other Names | 60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein |
|---|
| Gene, Accession # | SMARCD2, Gene ID: 6603 |
|---|
| Catalog # | NBP2-56267 |
|---|
| Price | |
|---|
| Order / More Info | SMARCD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|