| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Themis |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Themis Antibody from Novus Biologicals is a rabbit polyclonal antibody to Themis. This antibody reacts with human. The Themis Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Themis antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PFLVRTLVEEITEEQYYMMRRYESSASHPPPRPPKHPSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQAGLDSKVLIGSQNDLVDE |
|---|
| Other Names | bA325O24.3, bA325O24.4, C6orf190, C6orf207, FLJ40584, GASP, GRB2-associated protein, MGC163388, protein THEMIS, signaling phosphoprotein specific for T cells, thymocyte selection associated, thymocyte selection pathway associated, thymocyte-expressed molecule involved in selection, TSEPA |
|---|
| Gene, Accession # | THEMIS, Gene ID: 387357, Accession: Q8N1K5, SwissProt: Q8N1K5 |
|---|
| Catalog # | NBP2-38183 |
|---|
| Price | |
|---|
| Order / More Info | Themis Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|