| 产品详情 |
| Edit |   |
| Antigenic Specificity | Citron Kinase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Citron Kinase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Citron Kinase. This antibody reacts with human. The Citron Kinase Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Citron Kinase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NSLTHVPGIGAVFQIYIIKDLEKLLMIAGEERALCLVDVKKVKQSLAQSHLPAQPDISPNIFEAVKGCHLFGAGKIENGLCICAAMPSKVVILRYN |
| Other Names | CITK, citron (rho-interacting, serine/threonine kinase 21), Citron Rho-Interacting Kinase, Citron Rho-Interacting Serine/Threonine Kinase, CRIK, KIAA0949, MCPH17, Rho-interacting Serine/Threonine kinase 21, serine/threonine kinase 21, Serine/threonine-protein kinase 21, STK21 |
| Gene, Accession # | CIT, Gene ID: 11113, Accession: O14578, SwissProt: O14578 |
| Catalog # | NBP2-38592 |
| Price | |
| Order / More Info | Citron Kinase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|