| 产品详情 |
| Edit |   |
| Antigenic Specificity | CAD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CAD Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAD. This antibody reacts with human. The CAD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CAD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSR |
| Other Names | CAD protein, CAD trifunctional protein, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, anddihydroorotase, EC 2.1.3.2, EC 3.5.2.3, EC 6.3.5, EC 6.3.5.5, multifunctional protein CAD |
| Gene, Accession # | CAD, Gene ID: 790 |
| Catalog # | NBP2-56453 |
| Price | |
| Order / More Info | CAD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|