| 产品详情 |
| Edit |   |
| Antigenic Specificity | GPR63 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPR63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR63. This antibody reacts with human. The GPR63 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GPR63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ |
| Other Names | brain expressed G-protein-coupled receptor PSP24 beta, G protein-coupled receptor 63, probable G-protein coupled receptor 63, PSP24-2, PSP24-beta, PSP24BPSP24(beta) |
| Gene, Accession # | GPR63, Gene ID: 81491 |
| Catalog # | NBP1-82362 |
| Price | |
| Order / More Info | GPR63 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|