| Edit |   |
|---|
| Antigenic Specificity | GPR56 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPR56 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR56. This antibody reacts with human. The GPR56 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GPR56(G protein-coupled receptor 56) The peptide sequence was selected form the N terminal of GPR56. Peptide sequence MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN. |
|---|
| Other Names | BFPP, G protein-coupled receptor 56,7-transmembrane protein with no EGF-like N-terminal domains-1, Protein TM7XN1, TM7LN4G-protein coupled receptor 56, TM7XN1DKFZp781L1398 |
|---|
| Gene, Accession # | GPR56, Gene ID: 9289, Accession: Q9Y653, SwissProt: Q9Y653 |
|---|
| Catalog # | NBP1-62637-20ul |
|---|
| Price | |
|---|
| Order / More Info | GPR56 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|