| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UNKL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UNKL Antibody from Novus Biologicals is a rabbit polyclonal antibody to UNKL. This antibody reacts with human. The UNKL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human UNKL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC |
|---|
| Other Names | C16orf28, chromosome 16 open reading frame 28, EC 6.3.2.-, FLJ12623, KIAA0734, Putative E3 ubiquitin-protein ligase UNKL, RING finger protein unkempt-like, unkempt homolog (Drosophila)-like, unkempt-like, ZC3H5LMGC5179, ZC3HDC5LFLJ23360 |
|---|
| Gene, Accession # | UNKL, Gene ID: 64718, Accession: Q9H9P5, SwissProt: Q9H9P5 |
|---|
| Catalog # | NBP2-33766 |
|---|
| Price | |
|---|
| Order / More Info | UNKL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|