| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UQCR10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UQCR10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UQCR10. This antibody reacts with human. The UQCR10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. This product is specific to Subunit or Isoform: 9 |
|---|
| Immunogen | Synthetic peptides corresponding to UCRC(ubiquinol-cytochrome c reductase complex (7.2 kD)) The peptide sequence was selected from the middle region of UCRC. Peptide sequence LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK. |
|---|
| Other Names | Complex III subunit 9, Complex III subunit X, cytochrome b-c1 complex subunit 9, Cytochrome c1 non-heme 7 kDa protein, cytochrome C1, nonheme 7kDa protein, HSPC051, HSPC151, QCR9, ubiquinol-cytochrome c reductase complex (7.2 kD), ubiquinol-cytochrome c reductase, complex III subunit X, ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa, UCCR7.2, UCRCUbiquinol-cytochrome c reductase complex 7.2 kDa protein |
|---|
| Gene, Accession # | UQCR10, Gene ID: 29796, Accession: Q9UDW1, SwissProt: Q9UDW1 |
|---|
| Catalog # | NBP1-62349 |
|---|
| Price | |
|---|
| Order / More Info | UQCR10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|