| Edit |   |
| Antigenic Specificity | C2orf42 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C2orf42 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C2orf42. This antibody reacts with human. The C2orf42 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C2ORF42 The peptide sequence was selected from the N terminal of C2ORF42. Peptide sequence EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF. |
| Other Names | chromosome 2 open reading frame 42 |
| Gene, Accession # | C2ORF42, Gene ID: 54980 |
| Catalog # | NBP1-70466 |
| Price | |
| Order / More Info | C2orf42 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |